PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.002G230800.6
Common NameB456_002G230800, LOC105786246
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 313aa    MW: 33778.6 Da    PI: 7.0308
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.002G230800.6genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.61.8e-3099152155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Gorai.002G230800.6  99 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 152
                         59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.05996155IPR017930Myb domain
SuperFamilySSF466893.05E-2096156IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-3098157IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-24100152IPR006447Myb domain, plants
PfamPF002491.2E-7102151IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MREEDSNWFS RWEEELPSPD ELMPLSQSLI TPDLAMAFDI RNPNHHHAQQ QQSSVQPAPP  60
PPSAAVQPSS QPTLAEFAAD SGDLGSGAAG DEPARTLKRP RLVWTPQLHK RFVDAVAHLG  120
IKNAVPKTIM QLMSVDGLTR ENVASHLQKY RLYLKRMQGL SGGSGGGANG GSGGAGLGAS  180
ADPATDHLFA SSPVPPHFLH PGRGNSEHFL PFVPVPALQH HHHHQQQQIV AAAVGHPHLQ  240
SQYHRPQMGH YGSSPNSQFE HPFLGRQTQQ PMHRIGGTPM HNQAPSSYVE DLESANGNGG  300
RKVLTLFPTG DD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-2098157463ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2431270.0AC243127.1 Gossypium raimondii clone GR__Ba0222F01-hob, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012468058.10.0PREDICTED: transcription factor PCL1
RefseqXP_012468059.10.0PREDICTED: transcription factor PCL1
RefseqXP_012468060.10.0PREDICTED: transcription factor PCL1
TrEMBLA0A0B0NS740.0A0A0B0NS74_G
TrEMBLA0A0D2QHN70.0A0A0D2QHN7_G
STRINGPOPTR_0006s03340.11e-126(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.14e-88G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]